DPCstruct | MC6842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 9.17 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382HWC8 | 1-106 | MRPILTVSEGLVDEKDEHIVITYGSVGDDELVARISPPTNGVLTLQLLIDESRTDAEEVALEVRRRVNWLFIELGERRPWNYAQYHI… |
| A0A383B6Z2 | 9-114 | WRLVEGSVNIDEEHIKITYGAIDGDDFEPIALAAPGNNKTFTVQYLLKPEPENEDNQKMLDAVRKELNFYFLELKEKDPWAYACYHC… |
| A0A1J5F9X4 | 4-103 | None |
| A0A1F4D798 | 1-98 | None |
| A0A7Z9Q884 | 1-94 | None |
| A0A1V5N5C8 | 357-467 | None |
| A0A6M8VCB9 | 5-110 | None |
| A0A1G1KCK1 | 1-108 | None |
| A0A162FTN7 | 24-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.