DPCstruct | MC6840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G9AN26 | 1-106 | MKTLEIYPAMTLVHLQQQFSKLFPSLRIEPLIEHEVPNELQTLSDLAGHSVTNCFVLNGSMTINELDALFRECYGLPVRILRWMGYA… |
| A0A382HNH1 | 2-103 | AFSITGQIKVSTLKKRFHKEFGLTLRVYDGRSFADEDQTIGQIRKKKGSGDLSINKNMKVGTLEEKIEEEFGIKVQIAGSDDSYLCK… |
| A0A2T7BDY4 | 9-106 | None |
| A0A1Q6HJN4 | 9-120 | None |
| A0A4Q3RSX1 | 2-104 | None |
| A0A1F3LUC6 | 1-110 | None |
| A0A662ZAL8 | 1-111 | None |
| A0A2E3DAK7 | 1-125 | None |
| A0A847SNR3 | 1-113 | None |
| A0A6L3KG90 | 5-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.