DPCstruct | MC684
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 144 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 26.81 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | PF20026- CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H0VQG7 | 55-190 | KKSLLFLYVKELKEIAAHLSLSDKGNKMTVIMRILHFLETGQRLAAPKFPKEYCAQKGKIYPINENELMLKGAYKNDLEMRVFFKGL… |
| A0A1V5WE06 | 1-144 | MRPELNTNLDPSLFLEYYWLKEELSDFCRTQALPASGSKDELTARIHSFLKDGTVPEKRPQNTKVLQQSTCDSPLSPDSLIPAGYRN… |
| A0A354X1X8 | 4-152 | None |
| A0A6J7HG73 | 5-159 | None |
| A0A7K3XPI0 | 1-110 | None |
| A0A1G6H4E4 | 8-181 | None |
| A0A660EBT2 | 2-167 | None |
| B0N766 | 2-97 | None |
| A0A7M3LSR0 | 2-168 | None |
| A0A1I3HYP8 | 100-273 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.