DPCstruct | MC6838
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 111 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C0TL79 | 23-145 | PASMATKAEPIAKYDQDAIDEASLKNQFAYLKFITKDKSCDSNSQCQAIPVGSRACGGPSSYLVFSTKTADHKKVYELAKQLTHAES… |
| A0A6I7Q9Q4 | 22-126 | NSNADLSSKTIEEVALLINEEVGTADADSADRCDFIPIGVKPAGGPWGYLVFSSEKSSRERLEELIDRYNELDAERNIEDERMSTAD… |
| A0A3N0C0D3 | 7-105 | None |
| W0RLQ0 | 96-212 | None |
| A0A1F9MA22 | 158-269 | None |
| A0A0B8T185 | 24-139 | None |
| A0A542LNC0 | 7-104 | None |
| A0A0P7AL77 | 15-122 | None |
| A0A1V3MY35 | 99-198 | None |
| A0A1S1MUF1 | 20-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.