DPCstruct | MC6837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 12.17 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832BPE0 | 17-145 | LNSQGYSISAGVLNALDSDWETVSEIGGEIVDAPPFSEISDEAYRRNIEIIKQADAVVLTNLSIGRGNFKNLLCAKFAGENGKLIVV… |
| A0A7X8H8M6 | 2-117 | DSDQEMASKLGIPVIIEKPFSPISDENFQKAIHLAVQSDYIFIAPGYWGRGNLKNLDLAISLQERGKKILFLQDSFNQYWDYTEGQA… |
| A0A7V1KN29 | 209-318 | None |
| A0A7W1JQM5 | 2-105 | None |
| A0A7X8V3T9 | 3-107 | None |
| A0A5J4KGU3 | 21-157 | None |
| A0A1Q6YQH5 | 1-101 | None |
| A0A1V6JXU6 | 92-222 | None |
| A0A402CT71 | 297-424 | None |
| A0A7L4PV65 | 19-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.