DPCstruct | MC6835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 244 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F9DSJ4 | 6-241 | NTILNVIDIMSKAQWQTEENKLLNYWIAIESLANISKTEKESKFHFIKESISNIYFLWEQYSPIHELFRATDIYSRSSFEKDEKINI… |
| A0A417D689 | 47-302 | IDTIVLGCQEKGKETYSQLNKIVDLHNAALNQQDLNDAFLNLWSALEVASVTDSSKSKIESVTDNIVSILQNDYFECIFSNILDDLK… |
| A0A837FIE6 | 10-261 | None |
| A0A0K3A5Z8 | 383-625 | None |
| A0A2G4DMZ7 | 2-216 | None |
| A0A2A9KJ99 | 245-504 | None |
| A0A448T776 | 111-357 | None |
| A0A7Y3L633 | 1-248 | None |
| A0A193LD48 | 159-418 | None |
| A0A3A8JYC7 | 19-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.