DPCstruct | MC6833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 83 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 35.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8DQJ8 | 1-68 | MAYYFDIPFEETLIRHQQKPNAHEFGEVDMRKWWQERDFLGIIPEVKLSMDLSLNDIVNQISNDIAVQ |
| A0A806IMD1 | 1-87 | MEGILARDRYGKMLARLSQSFPRVLTYYFEVSFATTLARHQKRHRDFGVEDMRRWWLPHDTLGVANEVLIGEQQDLTTEVQQIMTAM |
| R6ZLT4 | 2-78 | None |
| S4MAN5 | 7-75 | None |
| A0A1I3C0X3 | 69-160 | None |
| S2RUJ9 | 30-107 | None |
| A0A3N1LHP2 | 84-186 | None |
| A0A7V9QVD8 | 39-130 | None |
| A0A2N3WMK0 | 53-146 | None |
| A0A1C4NAP0 | 3-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.