DPCstruct | MC6830
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4Z114 | 9-162 | KTNVFMKLVYTVFLALLVALFWGMGIAAFYPAPEAPETPAIVEQSYKNPGESLSPAEKTAQVAFEKEQKEYNEKMKTYSRNVSIIAL… |
| A0A832TDB5 | 8-193 | LKRGAVVIAIAVLTVLFIALLVDAVFESPRYEDYCGRGEMYDVPRPMMEKPAMNCTEPRQELMDKCYKSGGYPNWEFDENGCQVYKE… |
| A0A554MAE5 | 204-380 | None |
| A0A0F9S763 | 35-194 | None |
| A0A0G0I3M1 | 1-152 | None |
| A0A2H0BMM9 | 1-183 | None |
| A0A842UNZ5 | 5-182 | None |
| A0A7J4QIM8 | 46-253 | None |
| A0A0G1PBE5 | 10-195 | None |
| A0A177QRC6 | 54-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.