DPCstruct | MC683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 10.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.25 |
| Pfam Score | 93.33 |
| Assigned Pfam label(s) | CL0110- CL0020- CL0706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TFS4 | 6-114 | LATLRKSITAQSSWADKDEFLDVVYWIRQVVGFLTAIILGIIPITGAYGILLFFAINCAFVYFYSTTFQTVDEEEFGGYSEIIKEGL… |
| A0A6P6MMG1 | 15-125 | NGGLKQSTWSKAISCRAVWDEKDEFLDVVYWLRQIIAVLLGVIWGVAPLKGFLGIAIFCIINAGVLYVYISSFQQVDEEEYGGTWEL… |
| B3RVB8 | 2-91 | None |
| A0A830HBK5 | 138-273 | None |
| A0A2P6N160 | 4-111 | None |
| A0A834IJZ9 | 77-210 | None |
| A0A0D8XRA2 | 10-122 | None |
| A0A7M6DR39 | 10-124 | None |
| A0A3B3DG85 | 71-192 | None |
| A0A6D2J502 | 83-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.