DPCstruct | MC6827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 341 |
|---|---|
| Mean domain length (aa) | 204 ± 34 aa |
| Standard deviation of domain lengths | 34.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.00 |
| Pfam Score | 85.65 |
| Assigned Pfam label(s) | CL0413- PF09762- CL0219- PF12686 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4V549 | 4-203 | KTICGVDEAGRGPIIGPMVMAGVLIDEKDERKLRALGVKDSKLLTPPERERLFGGITEAIRESAILIISPQEIDAAVRGHDGLNLNR… |
| A0A6M8SRD1 | 2-179 | LICGVDEAGRGPLVGSVFAGAVILPSNHTIEGLNDSKKLSEKQRDRLAVCIKEQAIAWAVASATAAEVDEINILQATMLAMQRAVGA… |
| R6I256 | 11-327 | None |
| A0A0R1U4R3 | 49-278 | None |
| A0A5N6Q7Q9 | 577-788 | None |
| A0A504X274 | 203-430 | None |
| A0A7S1UQB0 | 1-201 | None |
| A0A0G4HZ33 | 18-213 | None |
| A0A486XP75 | 17-202 | None |
| A0A538QZN5 | 999-1211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.