DPCstruct | MC6826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 124 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4ULT7 | 118-235 | VSKLQYETENTTYDIRSVDPKRIIGASRLVVFNTRYKKLMIFESSPLVDGLSVKGTTIVGFDKKKSKERTVRKPQEILKDCSTGGIR… |
| A0A2D4YUH6 | 189-318 | QKRTRRKKVYSASEQTKKLNYNITDTEYHLTSLNPELIVGAMQLWTFNTKTKEITKFVAEDRMGLGVKGTTIQKFNNLSAMKKIGNK… |
| A0A2D6U0S9 | 187-318 | None |
| A0A350PL96 | 111-242 | None |
| A0A2M8AHP8 | 1-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.