DPCstruct | MC6825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4UL67 | 19-153 | TAREKTIFLAATKRVSPVMIPVSVFHTNLSTLQAVVYYLKHHLHLSTSNIASSLHRKPSTISMTYRAASAKLKGKMNVSDTSFTIPL… |
| A0A7J4LFT7 | 98-218 | EITIPSSIFNKELSSFESICKYLKENLHLKFSEIARLLSRDSRTIWSTYNNAKKKKPSQLIIADTEYLLPVSIFQNSELTILESIIL… |
| A0A2G9NGS7 | 31-154 | None |
| A0A2J6H057 | 43-162 | None |
| A0A842UY14 | 2-119 | None |
| A0A7C4V6F9 | 14-160 | None |
| A0A2H9PRW6 | 19-144 | None |
| A0A7J4TRY5 | 100-229 | None |
| A0A832TE36 | 17-168 | None |
| A0A7J3LNK6 | 46-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.