DPCstruct | MC6824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 190 ± 27 aa |
| Standard deviation of domain lengths | 26.58 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.83 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF13630- PF07853 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8AXY0 | 36-240 | RATWASLALVVVQFVVAFYLYPRMPERVAIHWGLSGEADGYGSRFLGLFLIPGVSLVFLPFLVALPRLDPSGGIERFRGGYDWFVFG… |
| A0A7J4UB75 | 6-205 | LIIVIIAASFIIPILSLQHLPDRIVTHWGIHDEPNGTMGKTIGVFFSPVLSLVFLGIFLLLPKIDPFKNNIEKFREQFDLFLVVFLL… |
| A0A352A4F9 | 1-192 | None |
| A0A0R1LJF4 | 22-202 | None |
| A0A1U7NMU5 | 4-205 | None |
| A0A7V7S6F7 | 3-208 | None |
| A0A514LGB8 | 5-154 | None |
| A0A539D5Q4 | 1-155 | None |
| A0A1M3IAY1 | 6-193 | None |
| A0A5B0WPP9 | 9-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.