DPCstruct | MC6823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V8V229 | 351-428 | TTRFLPIFPAACPSVTSVGGTYRVKPERAISFSSGGFSDTWPTPAYQQTAVRRYLNILGSRWQGLYNPGGRGFPDVAA |
| A0A4Z1JCW0 | 1-79 | MTHFPPQFPAACPWVTSVGGVRYIDPEQAVCSSSGDFSDLWPRPSYQQEVVEDFLQTQLGDRQKGLFDPHGRAFPDLSA |
| A0A4Z0A750 | 768-844 | None |
| A0A545UYZ6 | 445-528 | None |
| A0A4Q9MLU0 | 339-414 | None |
| A0A0M8MV95 | 39-121 | None |
| A0A4Y9Y668 | 418-495 | None |
| A0A4Y9YCT4 | 538-618 | None |
| A0A6A4GQ34 | 1-75 | None |
| J4GN63 | 366-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.