DPCstruct | MC682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 6.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151EFW2 | 1-61 | MKRPKSILFVVNDIENARRCVGNLPGIDIVQPSRLNVELLAPGGDPGRLAVFTEGALRSLG |
| S7MLR6 | 6-65 | RIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKL |
| A0A7C1GIX7 | 1-56 | None |
| A0A7J4L191 | 146-213 | None |
| O15594 | 144-216 | None |
| F6HC63 | 53-124 | None |
| A0A2B4SSK7 | 346-416 | None |
| A0A2I3TF82 | 140-223 | None |
| G1Q709 | 21-86 | None |
| A0A842W2Z4 | 89-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.