DPCstruct | MC6819
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 205 ± 53 aa |
| Standard deviation of domain lengths | 53.08 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.78 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF07286- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2QKT7 | 2-217 | VINMSLVGQEEFHSLYPYMLSVFEAGYSMGRLMTLFSPGEQIGDIVVPSGMFGVGTVCSITLNGVLNAHGIPVFSRFGGLLEYRDWK… |
| K9EE11 | 2-210 | LLYAQRNPQPVPLLDVIEAGSFESKLAAGSDLRTDIPRYRMWRDGELEEETTDATEAWAEHPDLVAFLIGCSFTFEVGLHAAGIEIR… |
| A0A066XHF5 | 13-290 | None |
| A0A225B8V9 | 18-284 | None |
| A0A7J6UMR5 | 56-316 | None |
| N4VMA5 | 7-294 | None |
| A0A1V5D9Y9 | 1-176 | None |
| A0A2K5UV09 | 311-547 | None |
| A0A7C6E158 | 112-327 | None |
| A0A7S2VZF5 | 8-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.