DPCstruct | MC6818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2XV22 | 2-78 | RVAVALFIITSIEVAIYYIEGLRGVLVELFLALSGLKFLLVVMWYMHLRFDSRLFSFLFAFGLTLAVCLFVAALATM |
| A0A5N8ZEW5 | 1-101 | MANEHSQSESHSHPGPREYVIIGIILAVITAIEVGVFYLQLSTLIMSLILLGLSAAKFYLVIMYFMHLKFDDKRFLLLFVAPMIIMV… |
| A0A7C1PCJ1 | 1-107 | None |
| A0A3N5K9B6 | 13-103 | None |
| A0A538CC67 | 15-115 | None |
| A0A6J4V1D2 | 17-117 | None |
| A0A2E5QHU8 | 49-145 | None |
| A0A535DS34 | 25-120 | None |
| A0A7V8X2U8 | 7-110 | None |
| A0A7V9SCB7 | 3-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.