DPCstruct | MC6817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 2539 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 21.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.52 |
| Pfam Score | 97.30 |
| Assigned Pfam label(s) | CL0023- CL0276- CL0238- CL0123- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9UD00 | 3-109 | KLSCNDSQTSIPDGSDLKLGRAQSNDIVCDDREASRFHGEFKVQSGQLTYRDLESTNGTLVNGEKVAPYMWQILTDGHTVQIGDWVA… |
| A0A7W1IPH7 | 70-191 | EGDFASALAGEWVVLAPAESSDAAQVMLFAKTKLMVGKLREPPVDLPLRNFPVAVHKDACQRVSRQHLAVRYDGILDGIVLEDLGGA… |
| A0A654HT94 | 120-276 | None |
| A0A654HXK8 | 1-100 | None |
| C4M4Q3 | 3-109 | None |
| F4PQ22 | 123-234 | None |
| F4Q1D0 | 513-622 | None |
| F4Q3P4 | 81-193 | None |
| A0A1Q9C407 | 332-477 | None |
| A0A848A8G6 | 3-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.