DPCstruct | MC681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 281 ± 28 aa |
| Standard deviation of domain lengths | 27.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A0EWQ1 | 3-310 | TPLIPQEIFLLERYSSLEYYGLARDAWEDVVKYVADYLARFMNDLPLDYRSRPLPEQPDIVWGERVLPNFQDTLAYLYDGYIKRSHS… |
| A0A6J5JFM2 | 6-300 | TMTPEQEQGARAQAFYLLKKWTSFTFLEYAVGLYRDFLGAYAKQLDTPSPNQVELEEAYRHDFLGALVRMDLGIDALRRGHDKRAAY… |
| A0A2W7NTT2 | 153-439 | None |
| A0A6A7MZP2 | 225-486 | None |
| A0A856Y4M8 | 6-230 | None |
| A0A2V4UQF7 | 3-253 | None |
| A0A077L0F9 | 143-386 | None |
| A0A4R6DWG6 | 1-318 | None |
| A0A1N6X4I8 | 6-290 | None |
| A0A375C624 | 11-286 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.