DPCstruct | MC6808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 427 ± 45 aa |
| Standard deviation of domain lengths | 44.62 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.63 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0745- CL0422- CL0100 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3JQ33 | 3-378 | SCYEYYMHGFRYSGQFEIDPDGANNGVGPFLVECDMTTTPPGKTIIHHTRDMEESSQILGHEACGSWSETMNYFSVDISTQMTPFVD… |
| A0A433TT23 | 86-590 | GNYAWYGRDGSKNYDWTPLPANGEDVESNCEVNAKLCNLCGNPKGFLVTQKDLLPVTRLVLAGSNIGVVIESAECFDLLSSCQEIYD… |
| A0A2B4SUJ4 | 28-383 | None |
| A0A2B4RJX8 | 102-523 | None |
| A9UW32 | 145-564 | None |
| A0A8B6F829 | 93-497 | None |
| E9GDI0 | 5-436 | None |
| A9UW31 | 238-671 | None |
| A0A1I8J2D8 | 15-408 | None |
| A0A2G8KW82 | 64-567 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.