DPCstruct | MC6807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 128 ± 21 aa |
| Standard deviation of domain lengths | 21.09 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03694 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U8QKC9 | 8-139 | LPPFDGLLPKWLALVSVVSAANSVQAYFSSSYTSELYNGRLADGSPHTNAHSSRLFGTWTFLSAVIRFSAAYNITTPVVYDLAAWTF… |
| A0A433TJI9 | 8-131 | VNLLRIWIGLIGMVAVGSTIRCFIAPNYAYEMIFSIDQNNVSALTSRLFGVWTFLSGVVRVMCAFDLHNRSLYHLTLFTFVLALVYF… |
| A0A1S3IUU7 | 9-98 | None |
| L8HEH6 | 3-104 | None |
| D3AVZ2 | 150-270 | None |
| A0A0W0DEX3 | 381-501 | None |
| A0A4S8JI40 | 381-510 | None |
| A0A439DKK7 | 186-318 | None |
| F4S9R8 | 2-118 | None |
| R1FCQ2 | 209-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.