DPCstruct | MC6805
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 107 ± 25 aa |
| Standard deviation of domain lengths | 25.19 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 92.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433SIA0 | 243-368 | SLEDMAIKTRDVRIQTLADTLGQANKDFLEFDKSPRRRVGELDTRGSHFYLSFYWAKALANQNDNQELKAIFAPIFAELEKNEAKIV… |
| A0A7X7CE28 | 143-267 | SFRQEAGNGNSRAAILADTLDLATERLLSENRSPSRRVREIDNRGSHLYLAAYWADALASQQEDAELAAAFAPVAAAFAEQVEAIAR… |
| A0A645HJD8 | 6-102 | None |
| A0A1Q9DTP5 | 415-542 | None |
| A0A7V8ZHF2 | 247-362 | None |
| A0A7S2UT29 | 333-452 | None |
| A0A0H4W841 | 6-73 | None |
| A0A813K417 | 931-1058 | None |
| A0A7X6UCR9 | 2-127 | None |
| A0A7C4IA93 | 374-502 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.