DPCstruct | MC6804
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 255 ± 28 aa |
| Standard deviation of domain lengths | 27.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q171U2 | 4-208 | DLALLILGGFRIHMASNQTYIDRLQTALKAQLINPDFADGVEVAITNFAQLYADPEFVKLACGIDMFFAVFPQHKRAKLRFGTLIMA… |
| A0A3S1HLA0 | 38-271 | NSTHSGLSASGVVSCPADINRLALSMMALYRICKVDHAQNEYRNSLIDKVSGLTSSTPFAEGTFPISQFLSLWDRALGIVTDTKFKR… |
| Q17MI8 | 116-390 | None |
| A0A177AQE6 | 58-313 | None |
| A0A7E4S2T3 | 372-607 | None |
| S4PDL9 | 80-355 | None |
| A0A0N5AGA5 | 14-283 | None |
| A0A164KMI7 | 22-275 | None |
| Q17Q60 | 53-338 | None |
| Q176X9 | 1-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.