DPCstruct | MC6802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 537 ± 82 aa |
| Standard deviation of domain lengths | 81.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 16.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S1CDL6 | 171-634 | SDRYNSDERHLVYHLPSSWDSVISYPISATDGAAMLRIQNQSVFYSLHLSGLAFPSTAYRALVLPLSCRKHSSESYEGSVLRLNVPW… |
| A0A224YY60 | 37-511 | FQALVVHVRPTTSKVIVVGERLRPSERWRDVRLPPWWGFSEVLLTVPLTEGAAFYNLSLHGLWHPWQAYRLTLQTKVCRTGTQGDGF… |
| A8Q503 | 37-588 | None |
| A0A6A2YNJ0 | 51-590 | None |
| A0A109FNB7 | 386-1106 | None |
| M5FYP4 | 284-867 | None |
| A0A835Q1V0 | 253-819 | None |
| A0A0G2ELB3 | 1-455 | None |
| A0A5D2XSY0 | 179-767 | None |
| A0A1B0GBB5 | 419-853 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.