DPCstruct | MC6800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 80 ± 7 aa |
| Standard deviation of domain lengths | 6.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 48.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0Z8N5 | 133-202 | AGECVSCDMFRPLEDLGLCPGCAAMLERDLIRQRDWEYSGTAFLLSDEAREELRRKIVAEYGEGLELIDP |
| D1JHS8 | 1-71 | MDDIFLCEECAGKRDLDLIRLRDWDYSITAFGVPDFKLEKLRGHVVAQYGKELELIAPKEKKKKKNHKHKR |
| A0A6M6E777 | 4-84 | None |
| A0A1F8NVH2 | 1-86 | None |
| A0A7C2XM89 | 284-355 | None |
| A0A3A0D4H5 | 87-166 | None |
| A0A7Y5QF43 | 1-88 | None |
| A0A3C1G5W2 | 236-310 | None |
| A0A7Y5CV70 | 174-259 | None |
| A0A849WGY4 | 11-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.