DPCstruct | MC680
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 193 ± 47 aa |
| Standard deviation of domain lengths | 46.53 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661EUY3 | 254-515 | QTLPAALNQTLAEALYQLIDFQHADYAQSYLDLIAEFDNDEAVQAAYAQHLALWLTYEDSPRVAQIKTKPSRFTEIAKEHGLKADQK… |
| A0A7W7Z556 | 29-276 | GLPEAVRPVASDAVFMLIDYQGPSYAQLYLDRLRRFVGRRGVGEELFAEIARLLAKRMCYEDVIRLAQLALQQPPGPGEVKTFRLDE… |
| A0A661G9A5 | 1-207 | None |
| A0A7Y2NC29 | 1-116 | None |
| A0A3C0PPQ7 | 92-341 | None |
| A0A7Y2GEI4 | 88-253 | None |
| A0A7S4NIX1 | 83-261 | None |
| A0A849A100 | 1-184 | None |
| N0E445 | 48-211 | None |
| A0A661EL10 | 42-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.