DPCstruct | MC68
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 200 ± 16 aa |
| Standard deviation of domain lengths | 16.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K2QH42 | 19-242 | RERQELAHRIGRTLAAEFNDRQVEGGGWRHQVAPVNFVSVLLTHPSGMSLSLTHEGSYRKGAAGRRLTVRGGYPSEYCGWRAEPVTV… |
| A0A1G6YCA2 | 9-198 | LRQLTITLADALCEHLAGNWRRTESPPAHAALTREGCELHLWGYEQRGIAHLTVQAQLPEGWGAVESVTPPEFALRADRDTESIAID… |
| A0A841BCX6 | 200-390 | None |
| A0A7W0W835 | 18-217 | None |
| A0A291W3E2 | 4-192 | None |
| G2G3J6 | 1-188 | None |
| A0A0M8SRC9 | 10-226 | None |
| A0A559V2P3 | 1-244 | None |
| A0A1I5GU95 | 5-184 | None |
| A0A6N7L1F3 | 13-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.