DPCstruct | MC6798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 259 ± 50 aa |
| Standard deviation of domain lengths | 50.44 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A328YW27 | 4-188 | TYLLVPRDPADVDMLIDAIRPAPAPQDIDVVIGMRGPIAPPEMCNGLMVPVVVFDQIYSFGRDELIRAIPKPEKMKEEEFSPAAEEL… |
| D1JG97 | 51-303 | GFIYAIGSIQPRFPTLSVEKEFAQAAPEGKAANLTDPQVLYEILSQEENRYLAREVCWVFTVESIDTYILQPRQYRELTQLVEAIKP… |
| I4FUV1 | 3-268 | None |
| B0JFK5 | 186-479 | None |
| A0A6L3ETP4 | 168-449 | None |
| A0A0D4DH05 | 131-310 | None |
| A0A846DKN1 | 877-1147 | None |
| A0A0S6UZH7 | 706-1003 | None |
| A0A2V8BF44 | 7-214 | None |
| A0A4R5GZU6 | 16-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.