DPCstruct | MC6796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 98 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09919 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9L756 | 6-99 | EDDDDPMLSVVNLIDLFLVIIGMLMVVIAQNPLNPFSEERVVVVENPGEDNMRITVKDGQELTRYESSGEMGEGQGARAGVTYRLDD… |
| D1J9S6 | 10-107 | EEEEDPLGGVANLFDAAMVFAVALLVALVLSYNVPELLDADASTTIVKNPGTPNMQVIIKEGQEIKVLNMTEQIAGGQGVKMGTAYR… |
| A0A7J2MG54 | 1-82 | None |
| A0A1H8EGI7 | 4-94 | None |
| A0A523CA02 | 22-120 | None |
| A0A5C6YM00 | 12-108 | None |
| A0A7C1B5V1 | 2-93 | None |
| A0A0C9Q5U3 | 46-148 | None |
| A0A2A2K8R3 | 786-881 | None |
| A0A3M1BHH3 | 15-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.