DPCstruct | MC6793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 24.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F7IBM1 | 18-125 | LTTQPSERAIKDQIALIRHIDDLIKLRNDPHVTPEKLPAVKTLLLKEINEWINRHLITKLDDQGQIELEKLLNSNESDEELDKFFSQ… |
| A0A838TVE6 | 1-117 | MNENIQIPEDIRQFLDGMLQEAGMLTLDDQMREGMIQELFYQLDNYLASVIVKSLEPEDLETFIKMNEEKKSKVEIEQFIAQKVPNA… |
| A0A7V6WKH3 | 1-112 | None |
| A0A2M7QHV1 | 4-132 | None |
| A0A1V5NGN3 | 16-118 | None |
| A0A2H0VZ71 | 1-105 | None |
| A0A1G2KQ34 | 2-99 | None |
| A0A847YZ14 | 12-118 | None |
| A0A1F7H0P2 | 25-133 | None |
| A0A7T5UPQ7 | 1-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.