DPCstruct | MC6792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 170 ± 39 aa |
| Standard deviation of domain lengths | 38.60 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 28.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0ASP3 | 4-113 | FYTGNTGRSRGPHLDFRVWDVEKGGYVDPTPHLSRLQSDGKAIIEQFEMTSPYGADRGSYIHKGVDYATPVGTAINVVGGKFIGTTN… |
| A0A136KQW2 | 2-164 | LDQTKSDEKKFQQLLSQALAEFQAINKAVETGQKVGEVKKGDPIALVGNTGYPNCSTGPHLHFEVRRDGQWIDPGGFVGSSWMWPLS… |
| A0A0G0BLH0 | 227-398 | None |
| A0A0G0SWI2 | 14-152 | None |
| A0A1F5GYU1 | 227-394 | None |
| A0A3M0Z1X5 | 166-344 | None |
| A0A2E0S7T1 | 883-1006 | None |
| A0A0G0D1J8 | 394-575 | None |
| A0A0G1NU75 | 76-280 | None |
| A0A0G0FVY0 | 45-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.