DPCstruct | MC6791
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 204 ± 43 aa |
| Standard deviation of domain lengths | 42.88 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.36 |
| Pfam Score | 99.32 |
| Assigned Pfam label(s) | CL0649- PF07004 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447MRW3 | 18-203 | GQLKANPEDFLVVEDLGFEPDGEGEHILVRILKNGCNTRFVAEALAKFLKIHAREVSFAGQKDKHAVTEQWLCARVPGKEMPDLSQF… |
| A0A1G2AP06 | 125-336 | SLMPSLASKKPHRFTYFWLQKSGLTTFDVLDCIKLFFKLKFDDVANQGLKDEDAITEQLISVKKILSKKDITAFNRKHGARNKYSRI… |
| A0A7J6PCF8 | 3-185 | None |
| A0A7J6PE54 | 319-552 | None |
| A0A7J6PVU7 | 193-422 | None |
| A0A5C6XGS8 | 27-222 | None |
| V5BTK0 | 49-207 | None |
| A0A2V2VTU6 | 102-319 | None |
| A0A2E9A3P2 | 182-365 | None |
| A0A538Q4U6 | 15-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.