DPCstruct | MC6789
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19652 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8K8W4 | 2-78 | IYYVECGNKFTLDYGDVDEFFYDALIEMYKRAITKVTKIPKKRQGSFRKRLEKIMKSSDGIGWGYHDDLCHFFYKAF |
| A0A2A8ILU6 | 9-124 | RGHGKLRLAEAKKEITAFKKATNDEKRTVDLMLFYVEMGVEFTNTYGDIDEQFYSSMVKMFDQVAMECDCDEDLYKVFSNRLETVLN… |
| A0A0E3QDL3 | 56-189 | None |
| A0A1G0FG88 | 3-112 | None |
| A3Z0R4 | 18-140 | None |
| A0A2V8AVB4 | 10-132 | None |
| A0A358U5U2 | 61-173 | None |
| A0A6V8MAM9 | 147-260 | None |
| A0A7T6Z1W1 | 62-177 | None |
| A0A1S8TKR3 | 6-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.