DPCstruct | MC6784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 170 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J8UAD0 | 1-161 | MSFRGGTAWRHLDTEREQLSLDLFWSTRKENPFRPDIMPVEELAPLSNFRSLRSLKLTGMLRSYQRHIWQTVWLNPGLEDLHLEMAL… |
| A0A6A6VWQ5 | 159-323 | WATELPFSPNLWPAIPTTIQDLNIDLKLPASEDGTPRFFNPHDLKPLRNYRNLHRLAIRGMSESYQGIIWETVWLNPNMHRLELRMA… |
| W9YG60 | 2-184 | None |
| A0A6A6BBV0 | 153-328 | None |
| A0A178ELL3 | 117-286 | None |
| A0A6G1HBD8 | 94-252 | None |
| A0A7R8AN54 | 94-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.