DPCstruct | MC6783
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 505 ± 49 aa |
| Standard deviation of domain lengths | 48.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.20 |
| Pfam Score | 93.18 |
| Assigned Pfam label(s) | CL0125- PF13446 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2WQR6 | 3-562 | PPLLAEELHDPDHSIFSVTVTPPNIPQPSAFSSRTDLSGYSGASPVQSTDQPTEEDLRTAVPHPNAYYCPRENGWVIFYWKSSSVAP… |
| A0A399GCS0 | 2-476 | APGKTAPRLLQDLFTYDPRHEERAGRNLLTSPPPQHDSKAPPIPAVPFRNCRHNLFTKSEQSLLPVPGEDPTSSTVYKVASYCIKCR… |
| A0A397UXR6 | 24-479 | None |
| A0A261Y3N4 | 68-483 | None |
| A0A6G1GHV2 | 13-568 | None |
| A0A0V1PR97 | 181-629 | None |
| A0A077WBW7 | 19-445 | None |
| C1H2U9 | 7-501 | None |
| A0A507BL01 | 35-574 | None |
| A0A0C2XSM9 | 30-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.