DPCstruct | MC678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0738 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E3JPQ0 | 1-74 | MFEITPNPNALKLNTEHTFEVGMDYFEVQESNPEMINKILSIEGVSSIFIGPNFLTLLKAVEYDWKDIKTTIEE |
| A0A2W4S771 | 93-192 | PRTSNDHGRARMTEPTVRFQPTPNPNAGKFATDRTVVQSGSRSYFSAEQAAGDPVAEALFAIPGVASVFMVADFITVTKTPQARWED… |
| A0A2E0C3U9 | 2-66 | None |
| A0A0G1DEF0 | 5-113 | None |
| A0A7J6KYN2 | 31-134 | None |
| M1YYW3 | 9-100 | None |
| A0A7R8XDX2 | 174-268 | None |
| A0A7J6CQV1 | 768-866 | None |
| A0A0D3CCR6 | 24-117 | None |
| A0A7R9KPV5 | 63-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.