DPCstruct | MC6779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.74 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 65.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C1Z3Q1 | 10-88 | SIVLVTFSERSRQSARECRARKKLRYQYLEELVADRERSVLALRKELDKYYKWSLDLDQGIVPEGLENVLLDVSVKQED |
| A0A2J7QMQ8 | 3-71 | AKLERSRQSARECRARKKLRYQYLEELVSDREKAVLALRKELEKYRSWGRELDEGRVPEGIPAMLEELG |
| A0A6H5IK94 | 34-116 | None |
| A0A0L7L3Z4 | 31-104 | None |
| A0A1E1W7X1 | 57-133 | None |
| A0A6A4V6F3 | 32-106 | None |
| A0A6A4JWT7 | 28-101 | None |
| A0A7R9C4C2 | 2-76 | None |
| A0A226ELP3 | 51-134 | None |
| A0A7J7BDC8 | 33-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.