DPCstruct | MC6776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 60.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673JIL9 | 266-366 | VFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCYTTSSGRVYTSDFEPVTNPKFDDGFEKNLTSVRQVKEIIHQFILEQQKGNRVP… |
| A0A4C1YUB8 | 1-105 | MGRNKTSQIPVNFQMLVFDPAKRISVVDALAHPYLEEGRLRYHSCMCKCCYSSPPAARHYSPDLEPTAPHAFHDSWERKLATVHQVK… |
| A0A1I8JL57 | 108-227 | None |
| A0A4Y7LWP7 | 231-339 | None |
| A0A0B2UMH3 | 201-322 | None |
| A0A194RNF5 | 173-239 | None |
| A0A5A9MXI2 | 172-277 | None |
| A0A402FYF0 | 1-119 | None |
| A0A2G9QG46 | 4-97 | None |
| A0A833ZG39 | 43-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.