DPCstruct | MC6775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 19.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2HF89 | 1-97 | MLPYDLYCPSVQSVLPTRVCKHCGLYFASNIMLKKHIIGVHKITGMCQPEVGRVRPLRIAARRQQKLMAVIAFTKNVEFADWVDEDD… |
| A0A4C1YQI9 | 88-225 | KFSPLLVRLSVDLSPPLEGFKQMPYDIFCSSVQFDLKNRICATCGIYFTSQKSVQTHSHSVRGKTTQDRREIRVRQQRFAASRASEL… |
| A0A817S773 | 3-159 | None |
| A0A212EMI2 | 175-300 | None |
| A0A164LH95 | 191-326 | None |
| A0A164KD94 | 406-509 | None |
| A0A4Y2SIR2 | 24-142 | None |
| A0A4Y2LNW1 | 13-141 | None |
| A0A4Y2U5K1 | 29-179 | None |
| T1EP50 | 545-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.