DPCstruct | MC6773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 5.56 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 64.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4C2AC66 | 1-70 | MASILVNGFKDHTHNRLLIDEAMMNHFGAIITAALLAKAKELLLIGDINQISHIDRHNVFPMSYEKPNTV |
| A0A4C1VPY6 | 5-80 | ASVLMNDFQRLKSCDRLIVDEALISHFGAVMATRLAGAKEVLLINDVNQLAFIDRLYFFEMQYIRPNLVATVKKEL |
| A0A835G574 | 184-254 | None |
| A0A4C1ZHW5 | 1-78 | None |
| A0A4C1W9H3 | 122-185 | None |
| A0A4C1T081 | 57-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.