DPCstruct | MC6770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 206 ± 31 aa |
| Standard deviation of domain lengths | 31.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5C1N0 | 13-209 | LVVWENTIRELFPIAIPNNCLWKSIDSVISILNKLSSVDNLNHTLFPAGGGHDLTGAKKSSEKGCIEFSTPNSVRIVKPKVLEFNYF… |
| A0A252E144 | 4-198 | RLSKLLADPLTFKKDSGKNNPIWWYRGYRNLQIESFEHLENNIVLINEQELQIKQVIAVNTRDYYQCFIYIETFPMEPSGLYNWEKR… |
| A0A1C2HXP3 | 89-318 | None |
| A0A4R8MIX0 | 142-391 | None |
| A0A7C8GTF3 | 10-225 | None |
| A0A219A7T8 | 17-156 | None |
| N1WIV4 | 9-189 | None |
| A0A413KND0 | 1-152 | None |
| A0A151UUY8 | 159-389 | None |
| I4D3V7 | 446-647 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.