DPCstruct | MC677
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835WRF1 | 18-103 | WRPSIDDIDSISWGGRAKVRGTGSRKIPHRLNAEERGLYDMAKKKGYVAVRGTAYRKERHGNPLPNIYRQWCDAKAQLCVVVEQDR |
| A0A2E5WN85 | 1-76 | MKILIDDVYRLAKGKPSRKKIGSRAIPARLNKYEWKEFEIAQKKGFLKVNSKTRDSLKNIWYLYCKSKNIEYRIIN |
| A0A7S1TCQ2 | 67-150 | None |
| A0A448YZC3 | 13-98 | None |
| A0A5J4Z366 | 101-194 | None |
| A0A383VHY7 | 1-90 | None |
| D7FPZ2 | 60-154 | None |
| A0A1Y1I6Y1 | 7-91 | None |
| A0A250XIL1 | 22-109 | None |
| A0A7X5JCK1 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.