DPCstruct | MC6769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M3PEZ1 | 54-126 | MFSKPDIQRVLETAFLPSKCECVVAPNETFSVKLLHPESGDIQLYVTGLSLSEVDSSRSIARLVLSLREQRDL |
| A0A5R8R4P5 | 3-75 | SLLELRHIIETAFLPTQCVCTIDADNRLMIQLINPVTQVEELTVAGIEPVDLSSSRAIAKFVVEIKEEARLRR |
| A0A365W8X0 | 13-92 | None |
| A0A0Q0BNU7 | 2-81 | None |
| J2TNP8 | 29-109 | None |
| A0A0A1Z3N1 | 7-86 | None |
| A0A0Q0BQ44 | 2-90 | None |
| A0A7T4UYL4 | 2-87 | None |
| A0A1V9UCU5 | 1-81 | None |
| A0A7Y5AAD7 | 32-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.