DPCstruct | MC6768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 204 ± 15 aa |
| Standard deviation of domain lengths | 15.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2G976 | 193-378 | YEIVEKTYKQYADKGMITVQLPKKITENQLSQIAHDIKEKVFQRASRVFMTYYLPHMKYGEGAWATTHYKSDYFDISIKGLTITQEE… |
| A0A7Z9PQ00 | 79-290 | QKVDAEQSNGKPTAAERREEAEREFEQRALSHVIDVIEQDRLSHMKRSILVELDQEVSMAELEVIGRMLQAQEPSFERTFIEYLLPG… |
| A0A2E9ML09 | 394-574 | None |
| A0A177KXT9 | 38-274 | None |
| A0A7G5ZG61 | 140-346 | None |
| A0A1G0RDB5 | 13-208 | None |
| A0A519TDC5 | 4-179 | None |
| A0A3R8Y794 | 27-234 | None |
| A0A1M3GHY7 | 31-247 | None |
| A0A2E5BT98 | 346-543 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.