DPCstruct | MC6766
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 15 aa |
| Standard deviation of domain lengths | 14.70 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V2CN82 | 63-170 | FHLDGRLTPQGRLTACPMCGCPELFVRKDFPPAIGVCIVIIAGLASIWFLRSSPSIAYAILAGAALLDLVLYLLFPKVTVCYRCRAE… |
| A0A7Z9NZU5 | 26-145 | VRLEQSGDDIFLDWNSTVDDSGRLRACVLCRGDVFRERTFPQITAIVIVLAFAGGVAGLLGLVTTWLMLIAMISVLLIDIIILIFSF… |
| A0A1G1NE02 | 2-86 | None |
| A0A7C4DNZ2 | 2-90 | None |
| A0A3D0MNJ1 | 35-151 | None |
| A0A3B8V4D2 | 14-138 | None |
| A0A075HZZ0 | 39-132 | None |
| A0A424PGM4 | 31-122 | None |
| A0A7Y3I4G9 | 31-167 | None |
| A0A2E6ZVY8 | 9-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.