DPCstruct | MC6765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 112 |
|---|---|
| Mean domain length (aa) | 143 ± 31 aa |
| Standard deviation of domain lengths | 31.04 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.85 |
| Pfam Score | 98.31 |
| Assigned Pfam label(s) | CL0125- CL0126- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8K9T2 | 22-173 | RVLQDGVFWTATQLFGLRFVERFDIPVYHPDVRVWEIFDHNGEGMALFYGDYYARDSKSGGAWMDVFVEQSTLREQRPVIYNVCNYA… |
| A0A7Z9MHI8 | 2-126 | IAEERGTPLWHDDVRLFEVWDTNSGKQLGEFYIDLHPRDNKYSHAAQWGLVQHKIWADGTEQLPIAALVCNFTKPTADKPSLMTHDE… |
| A0A392PQM5 | 11-112 | None |
| A0A4Z2HWQ0 | 9-180 | None |
| A0A0M8WP49 | 284-436 | None |
| A0A084RNU1 | 568-737 | None |
| A0A1A9X733 | 105-248 | None |
| A0A287XLK0 | 54-208 | None |
| A0A287XLI9 | 1-88 | None |
| A0A287XL43 | 200-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.