DPCstruct | MC6764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 138 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5B7Z8 | 479-614 | ITQGYSALGGGLRVDGTPTIRNCIIRDNNAQSAGGGLACSDPTGPTLENVRFCGNMVGTTLGAHCFGSWVDGGAVDLDDWCTCAGDT… |
| A0A2D5B5A1 | 321-442 | IQNGYSSITGGIKCNGNPTIRNCIIRDNRANLVVSGISSANAPGPSIENTHFCGNDLADTFGPMSIADDVTFADSCDVNPTCPGDFD… |
| A0A1Z8Y4L9 | 188-336 | None |
| A0A2D5E4U9 | 5-126 | None |
| A0A3L7SXG2 | 539-677 | None |
| A0A2D4WS36 | 297-456 | None |
| A0A7Y3MRZ3 | 158-299 | None |
| A0A2E0Y0L2 | 1-147 | None |
| A0A2D5M9N0 | 371-498 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.