DPCstruct | MC6763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 4.84 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 62.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2BFI5 | 61-122 | MNKEQFLFLVAIDAFKRANAKQFPTWTDVLEVIRLLGYRKTMPSELNLPNAEDWRESPNAPA |
| A0A7Z9IGC2 | 7-66 | EQFMFLVAINAFKEANGRTFPTWTDVLEVVRKLGYRKTLPSELNLNNKAEDWTEPADSDS |
| A0A7V1MB38 | 107-168 | None |
| A0A7D8UGP2 | 51-127 | None |
| A0A3C0EQH4 | 1-70 | None |
| A0A2E5G244 | 58-124 | None |
| A0A7Y3UC88 | 89-151 | None |
| A0A5M4D207 | 1-70 | None |
| A0A518C1C4 | 28-95 | None |
| A0A2D5I1T4 | 229-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.