DPCstruct | MC6761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 370 ± 26 aa |
| Standard deviation of domain lengths | 25.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5SWV3 | 26-410 | AGPDAVTGQIGAVANYAPVGDFEALGLGLTLCNRGNAGLVVNVNNAQHPIAIANLYKITLGPGPTRIEQIGMSWAFHEFAVLQTAVC… |
| A0A521GWN6 | 32-398 | GPAIGADVKVSALPDLHRWGRVGTVSSFNLGTTVCNIGDEIIPWVASTNHHPAIINNLYRLKDGRFEQVGMGWVKHGFFSTNSDGCG… |
| A0A523D5U5 | 46-427 | None |
| A0A3A0CQI4 | 24-425 | None |
| A0A7W2AUB2 | 29-396 | None |
| A0A2E1U9S5 | 1-332 | None |
| A0A7Y5RW77 | 210-590 | None |
| A0A5Q4ET98 | 119-496 | None |
| A0A6L3EJE9 | 140-536 | None |
| A0A2V5ZJ84 | 2-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.