DPCstruct | MC6760
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 12 aa |
| Standard deviation of domain lengths | 12.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.20 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0437- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1WVQ3 | 273-349 | MGELHLEILIDRMLREFKVEANIGAPQVAYRETVRKAANEVEGKFIRQSGGKGQYGHVVVNLEPGEPGSGFEFISKI |
| A0A7Y5SCF9 | 1-76 | MGELHLEIIQSRLLSEFGVRTNAGKPQIAYREAVAKAARGEYKLVKQTGGKGQYGHVVLRLSPNEKPRALARGSQT |
| A0A3B0WMX9 | 1-58 | None |
| A0A365VLW6 | 47-138 | None |
| A0A142YAV7 | 468-549 | None |
| A0A7R9R7I4 | 1-66 | None |
| A0A090SQ90 | 126-220 | None |
| A0A4R5JE43 | 90-181 | None |
| A0A7J6S3L0 | 31-95 | None |
| A0A150GJS3 | 46-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.